PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00025.1.g03190.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 281aa    MW: 30301.1 Da    PI: 5.9474
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00025.1.g03190.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.21.8e-334094661
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                    cprCds ntkfCyynnyslsqPryfCk+C ryWtkG +lrnvPvGgg+rkn++ 
  Zjn_sc00025.1.g03190.1.sm.mk 40 AFCPRCDSPNTKFCYYNNYSLSQPRYFCKGCCRYWTKG-SLRNVPVGGGCRKNQRG 94
                                  56**********************************95.9*************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-223793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.2294093IPR003851Zinc finger, Dof-type
PfamPF027012.4E-274193IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MPHYQPKHKI RAYIHVCPST DDILQIDEPL ISHRRIAAPA FCPRCDSPNT KFCYYNNYSL  60
SQPRYFCKGC CRYWTKGSLR NVPVGGGCRK NQRGKSARST LAAAAASGGA AAFSGRGTVR  120
PDLILEGMVG NQPVSDDKPV VAGRSAIDLA LLYAEFLKPQ PPPGEQCPAE PESVDTSSGS  180
SSGMSPKPQA GSALLEPRWC PDARGEELSF SVDQSCYDSL GLPTDGGDLI LPSTWCHESK  240
YELFDPLPED AMSLHDSIAG ADDVWSNAFA CQGLEAALCR P
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3937195e-57JN393719.1 Sorghum bicolor clone Sbdof25 Dof (Dof) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654467.11e-101PREDICTED: uncharacterized protein LOC102700144
TrEMBLJ3M7L31e-101J3M7L3_ORYBR; Uncharacterized protein
STRINGOB05G25870.11e-101(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-30Dof family protein